PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G0299
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 262aa    MW: 29876.5 Da    PI: 8.0622
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G0299genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.8e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed+llv++v+ +G g+Wk+ +++ g+ R++k+c++rw +yl
      Gh_A08G0299 14 RGPWSPREDKLLVNYVQSHGEGNWKSLPKKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding53.55.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T+eEd+l+++++ +lG++ W++Ia +++ gRt++++k++w+ +
      Gh_A08G0299  67 RGNITPEEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNCH 111
                      7999******************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.77961IPR017930Myb domain
SuperFamilySSF466891.61E-3111108IPR009057Homeodomain-like
SMARTSM007178.9E-141363IPR001005SANT/Myb domain
PfamPF002496.8E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-251568IPR009057Homeodomain-like
CDDcd001671.13E-111661No hitNo description
PROSITE profilePS5129426.00762116IPR017930Myb domain
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002495.0E-1567109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2669116IPR009057Homeodomain-like
CDDcd001672.09E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRAPCCSKV GLHRGPWSPR EDKLLVNYVQ SHGEGNWKSL PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TPEEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNC HLSKRLLNQG  120
TDPNTRKKLS QQATNTRKNI SDTSKTFSER PKIHLPKPIR VTRSSFPRNQ SFELDNHQCN  180
ANTQAGGNPS SDYAYAADHG GENMRGFLAD DLDIQFECES TVLVSEDDSS SLEKLYEEYL  240
QILNQNEDDE MQLDSFAQSL LI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.1050.0boll| ovule| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473382.10.0PREDICTED: myb-related protein 308-like
SwissprotQ9S9K92e-68MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A0B0MDX80.0A0A0B0MDX8_G
STRINGPOPTR_0002s17460.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-69myb domain protein 3